PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc01441.1.g00140.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 283aa    MW: 31930.9 Da    PI: 9.594
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc01441.1.g00140.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.31.3e-163882448
                                  S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
               Myb_DNA-binding  4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                  WTt+Ed+ll++ v+q+G g W++++++ g++R +k+c++rw +yl
  Zpz_sc01441.1.g00140.1.am.mk 38 WTTQEDKLLIEHVRQHGDGGWNSVSKHTGLKRNGKSCRLRWVNYL 82
                                  *****************************9*************97 PP

2Myb_DNA-binding51.81.8e-1689132247
                                   SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
               Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                   gr T +E+ ++v++++++G++ W+tIar ++ gRt++++k++w+++
  Zpz_sc01441.1.g00140.1.am.mk  89 GRITSQEERIIVQLHALWGNR-WSTIARSLP-GRTDNEIKNYWRTH 132
                                   789******************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.6693082IPR017930Myb domain
SuperFamilySSF466893.45E-2733129IPR009057Homeodomain-like
SMARTSM007171.4E-103484IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.0E-213889IPR009057Homeodomain-like
CDDcd001672.00E-103882No hitNo description
PfamPF002494.8E-153882IPR001005SANT/Myb domain
PROSITE profilePS5129424.02783137IPR017930Myb domain
SMARTSM007176.1E-1587135IPR001005SANT/Myb domain
PfamPF002491.5E-1389132IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.3E-2390135IPR009057Homeodomain-like
CDDcd001672.11E-1092133No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 283 aa     Download sequence    Send to blast
MVHSLFPAGQ HKRKERLAAS PAGRRSKATS LSRRSWLWTT QEDKLLIEHV RQHGDGGWNS  60
VSKHTGLKRN GKSCRLRWVN YLRPDLKHGR ITSQEERIIV QLHALWGNRW STIARSLPGR  120
TDNEIKNYWR THFKKAKPSK NIERARAQFL TQRREMQCQQ QQQQLQLVRK NEDNKLDATR  180
TAGTVEDEDR GSAVVDNACP ATTTAAVADQ SGHHLAADLV MHDAIMDFMC PMSFSLLLHV  240
AGGCCGSTSE EYRSSEEDGA TWGSLWNLED VFVNGGGGAC SLW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-243813530126MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004978126.11e-103PREDICTED: transcription repressor MYB6-like
TrEMBLK3Y9D01e-103K3Y9D0_SETIT; Uncharacterized protein
STRINGSi010822m1e-102(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP32433584
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G13480.13e-57myb domain protein 79